SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091V9W0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091V9W0
Domain Number 1 Region: 348-536
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.04e-66
Family Regulator of G-protein signaling, RGS 0.0000063
Further Details:      
 
Domain Number 2 Region: 744-972
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-62
Family DBL homology domain (DH-domain) 0.00000000284
Further Details:      
 
Domain Number 3 Region: 973-1107
Classification Level Classification E-value
Superfamily PH domain-like 1.69e-42
Family Pleckstrin-homology domain (PH domain) 0.0000022
Further Details:      
 
Domain Number 4 Region: 60-140
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-22
Family PDZ domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091V9W0
Sequence length 1271
Comment (tr|A0A091V9W0|A0A091V9W0_PHORB) Rho guanine nucleotide exchange factor 12 {ECO:0000313|EMBL:KFQ86478.1} KW=Complete proteome; Reference proteome OX=9218 OS=Phoenicopterus ruber ruber. GN=N337_08204 OC=Phoenicopteridae; Phoenicopterus.
Sequence
RFPLKKPTRHGSILSRESPADKKQKVERCSSTHDFDPTDSSSKKTKSSSEESRSETYGLV
QRCVVIQRDENGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHLE
VVKLIKSGSYVALTVQGRPPGSPQIPLADSEMDLAAFGHMSPIMTSPHSPGTSGNAERIT
SPVLMGEENNIVHNQKVEILRKMLQKEQERLQSLQEEYSRSPTTRLLKEIQETKKHIPQL
QEQLSKATGCTQVTECVRLLCVKTHGFPLSFEKENKNGSNVSNLAKKVFCAKRVIALYIS
SFSSLTPDSPQDSQSSVGSPLSRVGHQIIGAEDDDFDTEQEQMNGQCSCFQNIELLKSRP
AHLAVLLHHVVSQFDPAALLCYLYTDLYKQTNSKETRRVFLEFYQFFLDRAANLKVPVPD
EISLELDRRRPELLPEELHRQFVQTMQDKVCPEVQRNLEDFRQKRSMGLTLAEGELMKLD
AERVRDRNAVEKERACAEQIIAKIEEVLMTSQPLEEDKSSAMQYVILTYMKHLGVKVKEP
RNLEQKRGRIGFLPKIKQSIKKEKEGEEKGKRRGFPNILGPPRRPSRHDSSAIGRAMEMQ
KPRHPKHLPTASSVSPEPPDSSKMRQSGSSSDGTDAPYPPANPMSPLAMGPFSSPEVSKD
SETGLKQTGEAPPANDCMDGTPRTPNNTFEFPSPLENLQEEEGESERMVDMGTPKPFRKM
DSVGFADVQSEDELYDFDMDMDPPNWQQLVSREVLMGLKPYEIKRQEVINELFYTERAHV
HTLKVLHNVFYQRVTREGILNSSDKRKIFSNLEDILGLHVALNDQMKAVRKRNETSVIGQ
IGEDLLSWFSGPAEEKLKHATATFCSNQPFALEVIKSRQKKDSRFQTFVQDAESNPLCRR
LQLKDIIPREMQRLTKYPLLLDNIAKYTELPEEKEKVKKAADHCRQILNHVNQAVKESEN
KQHLEDYQRRLDLSYLKQSEDPMMDEFRNLDLTKRKMLHEGPLTWKVNRDKTIDLYTLLL
EDILVLLQKQDDKLVLKCHSKILASTADSKHTFSPIIKLNTVLVRQVATDNKAFFVISMS
ENGAHIYELVAQTVSEKNVWQDLIAQMAGTVKMGSTRRVIPLPQSGPGEEEREEEEQQKL
KEQHDIPAGSLQSPDKDLGLESSLILNVQSSSPIMSEKSKVESLLVSERQFDKVQQADLT
LKDSSACYEHATTSLPSVSEGQWALDALRNLGLLKQLLVQQLGFSEKGTLEDRQRFPRFR
TVSQEAQTESG
Download sequence
Identical sequences A0A091V9W0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]