SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091VH77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091VH77
Domain Number 1 Region: 150-279
Classification Level Classification E-value
Superfamily TNF-like 9.7e-39
Family TNF-like 0.0000487
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091VH77
Sequence length 286
Comment (tr|A0A091VH77|A0A091VH77_NIPNI) Complement C1q tumor necrosis factor-related protein 2 {ECO:0000313|EMBL:KFR01828.1} KW=Complete proteome; Reference proteome OX=128390 OS=Nipponia nippon (Crested ibis) (Ibis nippon). GN=Y956_14117 OC=Nipponia.
Sequence
CAMISAVLLLWTVPCVANHILGGFAKGALQEGPQLACSLPGPPGPPGPPGAPGAPGTVGR
MGFPGKDGKDGKDGDKGEHGDEGPQGRTGNPGKPGPKGKAGAIGKAGPRGPKGLKGNPGK
NGAPGKKGPKGNKGETGMPGPCTCNANKAKSAFSVAVSKSYPRERLPIKFDRILMNEGGH
YNASSGKFICSIPGIYYFTYDITLANKHLAIGLVHNGQYRIKTFDANTGNHDVASGSTIL
SLKQEDEVWLQIFYSEQNGLFYDPYWTDSLFTGFLIYPDQDYLNEI
Download sequence
Identical sequences A0A091M375 A0A091VH77

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]