SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091VL53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091VL53
Domain Number 1 Region: 297-556
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.59e-82
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 179-293
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-34
Family Kringle modules 0.00019
Further Details:      
 
Domain Number 3 Region: 19-68
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000006
Family Fibronectin type II module 0.0035
Further Details:      
 
Domain Number 4 Region: 75-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000155
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 114-154
Classification Level Classification E-value
Superfamily FnI-like domain 0.0001
Family Fibronectin type I module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091VL53
Sequence length 561
Comment (tr|A0A091VL53|A0A091VL53_NIPNI) Hepatocyte growth factor activator {ECO:0000313|EMBL:KFR03899.1} KW=Complete proteome; Reference proteome OX=128390 OS=Nipponia nippon (Crested ibis) (Ibis nippon). GN=Y956_04824 OC=Nipponia.
Sequence
HYKSGAGRGSKHEYTRPQVFTEDGNLCKFPFRYGGRFYHSCLSNLFSQKKWCSTTHNYDR
DRRWGHCAPLPKDHSDHCASNPCQNGGTCSLAHGHRMYHCTCPEEFMGEDCQMKKCFDNS
LYEFFDVGMSWSRVQQGAVEQCVCVNGQIECESVEHKSCVHDPCMNGGECKMVTFSEKIV
CDCKGNYAGKYCNIVPSHRCYVGNGTEYRGTAKTTISGHRCLPWDSDLLYQELHVDSVEK
AVQLGLGPFSYCRNPDDDEKPWCYIMKDNNLSWEYCDIPSCASRERRPPVPDNVDSFAVT
RRPCGRRHKKRSFVRPRIIGGSSSLPGSHPWIAAIYIGESFCGGSLIQTCWVVSAAHCFA
NSPLKSTIKVVLGQHIFNRTTDVTQTFEIEKYILHPQYSVFNPTEHDIALIKLKKNGQRC
AIKSQFVQPICLPESNTVFPDQFKCQISGWGHRHENISGYSNVLQETLIPIIPEEKCRSP
EIYGTEITENMFCAGYFDSKSDACQGDSGGPLACEKNEISYLYGVISWGDGCGRVNKPGV
YTRITNYVNWINEKIAPAKSS
Download sequence
Identical sequences A0A091VL53

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]