SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091VQD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091VQD8
Domain Number 1 Region: 1-50
Classification Level Classification E-value
Superfamily SH2 domain 0.00000138
Family SH2 domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091VQD8
Sequence length 51
Comment (tr|A0A091VQD8|A0A091VQD8_OPIHO) SH2 domain-containing protein 2A {ECO:0000313|EMBL:KFR05414.1} KW=Complete proteome; Reference proteome OX=30419 OS=Opisthocomus hoazin (Hoatzin) (Phasianus hoazin). GN=N306_08157 OC=Opisthocomus.
Sequence
CRHFVLDQLPDGQYVILGERSAHAELADLLRHYAAAPITPYHEFLTVPCGR
Download sequence
Identical sequences A0A091VQD8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]