SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091VTS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091VTS4
Domain Number 1 Region: 19-151
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.84e-37
Family Regulator of G-protein signaling, RGS 0.00011
Further Details:      
 
Domain Number 2 Region: 284-375
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-17
Family Ras-binding domain, RBD 0.00069
Further Details:      
 
Domain Number 3 Region: 249-297
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000964
Family Ras-binding domain, RBD 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091VTS4
Sequence length 447
Comment (tr|A0A091VTS4|A0A091VTS4_OPIHO) Regulator of G-protein signaling 14 {ECO:0000313|EMBL:KFR05883.1} KW=Complete proteome; Reference proteome OX=30419 OS=Opisthocomus hoazin (Hoatzin) (Phasianus hoazin). GN=N306_11201 OC=Opisthocomus.
Sequence
RGSNHSVNSLPGPSATCGSTQGSVVSWAESFETLLQDRVAVTYFTEFLKKEFCAENVYFW
QACERFQQIPASDTQQLAQEARRIYDEFLSSHSVSPVNIDKQAWIGEDMLATPSPDMFRV
QQLQIFNLMKFDSYTRFVKSPLYQACLRAESQGQPLPDLRPHSRSSSPPPDLSKVRGGLG
DRRKGRGSLGCPRAEMLLCSPQKLREPSWAGSGSSMLWRESQGSLNSSASLDLGFLSSAS
TAASPWTESIRDMLAGICEKRGFSLPDIKVYLVGNEQKALVLDQECSVLADQEVKLENRI
SFELEISSLSKTIRITAKSTKRIREAWLPLACCSKRGIAWLFPLQQGEPAALDLEKLVST
VAAQKLVLETPAAQEGSPTGAEPDALWEMPSSFSRPRSSAAMNLNRRTYDLEGSHGCWSR
EKSCRANDQRGLLSKEDLVLPDFLQLP
Download sequence
Identical sequences A0A091VTS4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]