SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091VZW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091VZW9
Domain Number 1 Region: 6-48
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000017
Family Hairy Orange domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091VZW9
Sequence length 164
Comment (tr|A0A091VZW9|A0A091VZW9_NIPNI) Hairy and enhancer of split-related protein HELT {ECO:0000313|EMBL:KFR08749.1} KW=Complete proteome; Reference proteome OX=128390 OS=Nipponia nippon (Crested ibis) (Ibis nippon). GN=Y956_01135 OC=Nipponia.
Sequence
ELLSEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSKARFVTEPLFTSL
GSLPEPDFSYQLHPGPECPGHGHSPGEAALPPPSGGPFPWHGAGRSPPLPYHLPNAAVPL
ASPGQQRSTFLSSVQGLIRHYLNLLGHSHPNAFGLPPGQHPSML
Download sequence
Identical sequences A0A091VZW9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]