SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091W395 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091W395
Domain Number 1 Region: 12-116
Classification Level Classification E-value
Superfamily Prefoldin 0.0000000000458
Family Prefoldin 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091W395
Sequence length 127
Comment (tr|A0A091W395|A0A091W395_OPIHO) Prefoldin subunit 4 {ECO:0000313|EMBL:KFR10117.1} KW=Complete proteome; Reference proteome OX=30419 OS=Opisthocomus hoazin (Hoatzin) (Phasianus hoazin). GN=N306_01687 OC=Opisthocomus.
Sequence
AAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMMLDDCDPLLI
PYQIGDVFISHSQEETQEMLEEAKKSLQEEIEALESRVESIQRVLSDLKVQLYAKFGNNI
NLEAEDS
Download sequence
Identical sequences A0A091W395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]