SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091WH55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091WH55
Domain Number 1 Region: 2-249
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-73
Family Protein kinases, catalytic subunit 0.0000201
Further Details:      
 
Domain Number 2 Region: 259-336
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000412
Family Regulator of G-protein signaling, RGS 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091WH55
Sequence length 953
Comment (tr|A0A091WH55|A0A091WH55_OPIHO) Mitogen-activated protein kinase kinase kinase 9 {ECO:0000313|EMBL:KFR14894.1} KW=Complete proteome; Reference proteome OX=30419 OS=Opisthocomus hoazin (Hoatzin) (Phasianus hoazin). GN=N306_12182 OC=Opisthocomus.
Sequence
WGKVYRAVWIGDEVAVKAARYDPDEDISQTIENVRQEAKLFAMLKHPNIIALRGVCLKEP
NLCLIMEFARGGSLNRVLSGKRIPPDILVNWAVQIARGMNYLHEEAIVPIIHRDLKSSNI
LILEKVENGDLSNKILKITDFGLAREWHKTTKMSAAGTYAWMAPEVIRSSMFSKGSDVWS
YGVLLWELLTGEVPFRGIDGLAVAYGVAMNKLALPIPSTCPEPFAKLMEDCWNPDPHSRP
SFASILDHLTAIEESGFFEMPKDSFHSLQEDWKQEIQEMFDQLRAKEKELRTWEEELTRA
AVEQKNHEELLRRREQELAEREIDILERELNIIIHQLCQEKPRVKKRMGKFKRNRLKLKD
GNHISLPSDFQHKFTVQASPTMDKRKSLISSCSSPPASPTIIPRLRAIQCKELNVVLNLG
NVHSVLPREEGEEEEKRSQKKKGRTWGPSSLGHKDLGAGEDGTECVFSQLHVNLPFLNSS
LPVFLKALVEGYRQWSSSAPNLGKIQRTAPAFPGFTSLAEMDDEDSECLNGEGKVHPSPG
HNQSYLCIPFQKNEDWDGPSSDANEESTPVNSATSTPQLTPTNSLKRSGSHHKRCEVALL
GCGAVLAAAGLGFDLLEAGKCQLLIEEEPEAPKEEKKKRDSIFQRAGRPRRSTSPPSRKI
FKKEDPMLLLGEPSTSLTLLSLSSISECNSTRSLLRSDSDEIVVYEMPVSPVTVKAPLPA
ITNPLVNVQIERFKQDPNQSLTPTHVTVSSHPQQSGHRRTPSDGAIKGSGLVVNGCPTSG
CPSSSCLTGALGAGVLKTPSPSRDPNEVPRLPDPNLVFPPTPRRWNAQQDPTLERPKTLE
FLPRPRPAASRQRLDPWWFVSPSNAKGESSANSSSTDTPSNLDSCFASSSSTVEERPGLP
ALLPFQVGLPVEERTLLDIDAEGQSQDSTIPLCRSELNTHKAAAYELKQEFWS
Download sequence
Identical sequences A0A091WH55

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]