SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091WKT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091WKT0
Domain Number 1 Region: 60-194
Classification Level Classification E-value
Superfamily BAG domain 1.44e-51
Family BAG domain 0.00000359
Further Details:      
 
Domain Number 2 Region: 14-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000806
Family Ubiquitin-related 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091WKT0
Sequence length 194
Comment (tr|A0A091WKT0|A0A091WKT0_OPIHO) BAG family molecular chaperone regulator 1 {ECO:0000313|EMBL:KFR02181.1} KW=Complete proteome; Reference proteome OX=30419 OS=Opisthocomus hoazin (Hoatzin) (Phasianus hoazin). GN=N306_08361 OC=Opisthocomus.
Sequence
NEKHSIRVASQQDDGEPTLQDMAVLIEQVTGVPVSFQKLIYKGKSLKELEQPLSALGVKN
GCKVMLIGKRNSPEEEAELKKLKDLEKSVEQIANKLEEVNKEFTSIQKGFLAKDLQAEAL
KQLDKRIKGTAEQFMKILEQIDAMNLPENFSDCKLKKKGLVKRVQVFLAQCDTVEGNIGQ
EMDKLQSKNLALAE
Download sequence
Identical sequences A0A091WKT0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]