SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091X8E5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091X8E5
Domain Number 1 Region: 110-194
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000903
Family DEATH domain, DD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091X8E5
Sequence length 199
Comment (tr|A0A091X8E5|A0A091X8E5_OPIHO) Ectodysplasin-A receptor-associated adapter protein {ECO:0000313|EMBL:KFR09676.1} KW=Complete proteome; Reference proteome OX=30419 OS=Opisthocomus hoazin (Hoatzin) (Phasianus hoazin). GN=N306_02735 OC=Opisthocomus.
Sequence
DHAAKEPVEDTDPSTLSLTMTEKYPVQDTGVPKDEEYLTDQVTLEIASVNIKTLTSDSGL
IQQPEDKDLQNHSDESLSDLKKTCKENGSCSLCLFRAPTISDMLNDEDLLYTVRLKLDPC
HPTVKNWRNLASKWGMTYDELCFLEQKPQSPTLEFLLRNSDRTVEQLIDLCKFYKRIDVV
KVLLKWVEEEWPKRGNRTY
Download sequence
Identical sequences A0A091X8E5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]