SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093BKQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093BKQ7
Domain Number 1 Region: 215-295
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 2.22e-19
Family HSP40/DnaJ peptide-binding domain 0.0006
Further Details:      
 
Domain Number 2 Region: 72-104,171-214
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 4.06e-18
Family HSP40/DnaJ peptide-binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 96-168
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.00000000000000536
Family DnaJ/Hsp40 cysteine-rich domain 0.00028
Further Details:      
 
Domain Number 4 Region: 2-59
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.000000000432
Family Chaperone J-domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093BKQ7
Sequence length 331
Comment (tr|A0A093BKQ7|A0A093BKQ7_CHAPE) DnaJ subfamily A member 1 {ECO:0000313|EMBL:KFU87753.1} KW=Complete proteome; Reference proteome OX=8897 OS=Chaetura pelagica (Chimney swift). GN=M959_02308 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Apodidae; Chaetura.
Sequence
QFKQISQAYEVLSDSHKRALYDRGGERAMKEGGLGNRGGSSSGFGSPMDIFDLFFGGGVR
MRGRADRRGKTVVHQLSVSLEDLYNGTTRKLSLQKNIICRKCGGCGVREGAQRRCPKCHG
SGMEVRIHQLGPSMIQQIQTVCSQCQGQGEWIRPRDCCLTCNGRKVVREKKILSVHLDKG
MKDGQKITFHEEGDQVPGLEPGDIIIVLDQKEHPVFRRSGDDLVVKREISLADALCGCRQ
LIRTLDNRALLISSQPGDVIRPGDMKCVPNEGMPVYRSPFQKGKLIVQFQVKFPEPGWLP
PDRLRQLQTFFPPQEEVMATEETEEVELSDY
Download sequence
Identical sequences A0A093BKQ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]