SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093BN71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093BN71
Domain Number 1 Region: 714-930
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.32e-53
Family DBL homology domain (DH-domain) 0.0000000129
Further Details:      
 
Domain Number 2 Region: 933-1066
Classification Level Classification E-value
Superfamily PH domain-like 4.38e-42
Family Pleckstrin-homology domain (PH domain) 0.00000078
Further Details:      
 
Domain Number 3 Region: 383-486
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.71e-23
Family Regulator of G-protein signaling, RGS 0.0000134
Further Details:      
 
Domain Number 4 Region: 6-85
Classification Level Classification E-value
Superfamily PDZ domain-like 5.26e-21
Family PDZ domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093BN71
Sequence length 1083
Comment (tr|A0A093BN71|A0A093BN71_CHAPE) Rho guanine nucleotide exchange factor 11 {ECO:0000313|EMBL:KFU92195.1} KW=Complete proteome; Reference proteome OX=8897 OS=Chaetura pelagica (Chimney swift). GN=M959_03236 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Apodidae; Chaetura.
Sequence
TPGLVQRCVIIQKDQHGFGFTVSGDRVVLVQSVRPGGAAMRAGVQEGDRIVKVNGTMVTN
SSHLEVVKLIKSGAYVALTLLGSPPPSVGLSSSHPDATTTGSPRVTPSCPPPPPAPPLKK
GPQTPAGTKGRGFLEVQKHAAQILRNMLRQEEAELQRFYEAYSRNPGSGVEEQIEGARRR
VSQLQLKILQETQGSLDSGRLGSDSSLAGFRMGEGRLSLDSQDGDSGLESGTERIPSGSE
VSFTRNSILSDQGGDSPRTSPLVTARHRRHGSDPPFTDQGVPWQDKAGQPLIIGPEEDCD
PGYFNNESDSVFQELGQLQARPAHLGVFLRYLLSQADPSALVGARTPGGEGTPKPGGGRG
LEGGRWDETGRGEMEMRSWEETLDHEETRLRNGDDVRAALLEAQEMVMPEIQEQIQDYRT
KRTMGLGSLYGENDLLELDGDPQKERQVAEKQLVQLGDILSKYEEDRSSPMAFALSTYMN
HVGIRSRDSRPGGPTEKTSSLPDRDKWLPFFPKAKKSSSTKKDKDALEDKKRNPILKYIG
KPKISSQSTFHVPLSPVEAVRPGSVRNIIQHFENNQHQEIQDLGPQRLSTGSFPEDLLES
DGSRAEVKLGRSESLKGREELKKSRKAENVPRSRSDVDMDAAAEATRLHQSASSSASSLS
TRSLDNPTPPYTPKMGRRSIESPNLGFGVDPFLPHLLEDEQGQLSDLEPELDSQNWQQMV
SKDLVANMSQKEIDRQEVINELFATEGSHLRILRWNLPNREELGLLFPNLPDLIEIHNSL
SESMKKLREEGPIIKEIGDLMLSRFDGLAKEEIQEVAANFCSYQSIALELIKTKQRKETR
FQIFMQEAESNPQCRRLQLKDLIISEMQRLTKYPLLLENIIKHTQAGTLEHEKLCRARDQ
CRDILKHVNEAVKRAENRHRLEGYQKRLDTTSLERTSNPLAAQFKSLDLTSRRMIHEGPL
TWRVGKDKTVDLHVLLLEDLLVLLQKQDEKLVLKCHSKTALGSSDNKQTFSPVLKLNSVL
IRSVATDKRALFIICTSELGPQIYELVALTSSEKNTWMELLEEAVQSATRNVTCPPKRRA
LEP
Download sequence
Identical sequences A0A093BN71

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]