SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093BR97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093BR97
Domain Number 1 Region: 18-251
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.59e-52
Family Ankyrin repeat 0.0000844
Further Details:      
 
Domain Number 2 Region: 265-309
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000458
Family SOCS box-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093BR97
Sequence length 314
Comment (tr|A0A093BR97|A0A093BR97_TAUER) Ankyrin repeat and SOCS box protein 7 {ECO:0000313|EMBL:KFV04713.1} KW=Complete proteome; Reference proteome OX=121530 OS=Tauraco erythrolophus (Red-crested turaco). GN=N340_05719 OC=Tauraco.
Sequence
MLHHHCRRNPELQEELQIQAAVAAGDVHTVRKMLEQGYSPNGRDANGWTLLHFSAASKEE
ILHSEGADPTVKDLIGGFTALHYAAMHGRARIARLMLESEYRSDIINAKSNDGWTPLHVA
AHYGRDSFVRLLLEFKAEVDPLSDKGTTPLQLAIIRERSSCVKILLDHNANIDIQNGFLL
RYAVIKSNHSYCRMFLQRGADTNLGRLEDGQTPLHLSALRDDVLCAQMLYNYGADTNTRN
YEGQTPLAVSISISGSSRPCLDFLQEVTRQPRNLQDLCRIKIRQCIGLQNLKLLDELPIA
KVMKDYLKHKFDDI
Download sequence
Identical sequences A0A093BR97

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]