SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093BTB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093BTB7
Domain Number 1 Region: 2-129
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.01e-47
Family Regulator of G-protein signaling, RGS 0.00000757
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093BTB7
Sequence length 130
Comment (tr|A0A093BTB7|A0A093BTB7_TAUER) Regulator of G-protein signaling 2 {ECO:0000313|EMBL:KFV06985.1} KW=Complete proteome; Reference proteome OX=121530 OS=Tauraco erythrolophus (Red-crested turaco). GN=N340_01026 OC=Tauraco.
Sequence
RPSPEEAQLWSEAFDELLANKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLTS
KAKKIYNDFIEKEAPKEINIDFQTKNMIAQNIQEATHTCFSAAQKRVYSLMENNSYPRFL
ESEFYQELCK
Download sequence
Identical sequences A0A087VFT4 A0A091JVX3 A0A091MNR6 A0A091SXA5 A0A091VZM5 A0A093BTB7 A0A093Q242 A0A094N2D0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]