SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093BWW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093BWW0
Domain Number 1 Region: 150-490
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.01e-88
Family Protein kinases, catalytic subunit 0.00000000000819
Further Details:      
 
Domain Number 2 Region: 1-147
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.68e-40
Family Regulator of G-protein signaling, RGS 0.000000361
Further Details:      
 
Domain Number 3 Region: 517-625
Classification Level Classification E-value
Superfamily PH domain-like 7.12e-25
Family Pleckstrin-homology domain (PH domain) 0.00000488
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093BWW0
Sequence length 651
Comment (tr|A0A093BWW0|A0A093BWW0_9AVES) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=240206 OS=Pterocles gutturalis (yellow-throated sandgrouse). GN=N339_11944 OC=Pterocles.
Sequence
SIRSVMQKYLEERGELTFDKIFHQKIGFLLFKDYCMNEIDEAVPQLKFYEEIKEYEKLDS
EEERLSRSRQIYDTYIMKELLSCSHPFSKQAVDHVQTHLAKKQVPASLFQPYIEEICDSL
RGKIFQKFMESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMY
AMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGG
DLHYHLSQHGVFSEKEMRFYATEIILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLG
LACDFSKKKPHASVGTHGYMAPEVLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTK
DKHEIDRMTLTVNVELPESFSPELKSLLEGLLQRDVSKRLGCQGRSAQEVKEHPFFKGID
WQQVYLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYKNFPLVISERW
QQEVAETVYDAVNADTDKIEARKRAKNKQLGHEEDYALGKDCIMHGYMLKLGNPFLTQWQ
RRYFYLFPNRLEWRGEGESRQNLLTMEQIVSVEETQIKDKKCILLRIKGGKQFVLQCESD
PEFVQWKKELTEAFTEAQRLLRRAPKFLNKSRSTVVELSKPPLSHRNSNGL
Download sequence
Identical sequences A0A093BWW0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]