SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093BX15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093BX15
Domain Number 1 Region: 32-168
Classification Level Classification E-value
Superfamily Lipocalins 9.04e-16
Family Retinol binding protein-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093BX15
Sequence length 169
Comment (tr|A0A093BX15|A0A093BX15_TAUER) Alpha-1-acid glycoprotein {ECO:0000313|EMBL:KFV05399.1} KW=Complete proteome; Reference proteome OX=121530 OS=Tauraco erythrolophus (Red-crested turaco). GN=N340_01906 OC=Tauraco.
Sequence
LALLLGLPLALAEPPTCAPLVPVTLDNATISQLLGQWIYITGGSKYPPHLEELKAVKYAA
FSFSPGSHEDELNVTEVMRVNKTCVFTNTSKIRIFWHNSTLVHVNDQVESMAKLIQSDKD
LLILKYTNADFPGLSLSARTANVSKEHLEEFKAQLHCLGFTEDEVFFTS
Download sequence
Identical sequences A0A093BX15

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]