SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093C7X2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093C7X2
Domain Number 1 Region: 12-68
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000859
Family Ovomucoid domain III-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093C7X2
Sequence length 69
Comment (tr|A0A093C7X2|A0A093C7X2_9AVES) Chymotrypsin inhibitor {ECO:0000313|EMBL:KFV10523.1} KW=Complete proteome; Reference proteome OX=240206 OS=Pterocles gutturalis (yellow-throated sandgrouse). GN=N339_12996 OC=Pterocles.
Sequence
GCAGTEMCAAVSPFQPVCGDMVSLEACPLLYLPVCGTDGNTYANECQLCAHQMKTRQDIR
ILKDRECED
Download sequence
Identical sequences A0A093C7X2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]