SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093CA24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093CA24
Domain Number 1 Region: 19-67
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000157
Family Fibronectin type I module 0.053
Further Details:      
 
Domain Number 2 Region: 2-28
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000327
Family ATI-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093CA24
Sequence length 322
Comment (tr|A0A093CA24|A0A093CA24_9AVES) Mucin-5B {ECO:0000313|EMBL:KFV09142.1} KW=Complete proteome; Reference proteome OX=240206 OS=Pterocles gutturalis (yellow-throated sandgrouse). GN=N339_01665 OC=Pterocles.
Sequence
TECVSGCMCPDGLVLDGSGGCIPKDQCPCIHGGHFYKPGETIKVDCNTCTCNKRQWNCTE
NPCKGTCTVYGNGHYMSFDGEKFDFLGDCDYILAQDFCPNNLDAGTFRIVIQNNACGKSL
SICSLKITLIFEVGLELIITDGAEKNYKVDLRGGYIVIETNQGMNFMWDQKTTVVVHVAP
SFQGKVCGLCGDFDGRSRNDFTTRGQSVEMSIQEFGNSWKITSTCSNINMTDLCADQPFK
SVLGQKHCSIIKSSIFEACHSKVNPIPYYESCISDFCGCDSVGDCECFCTSVAAYSRSCS
RAGVCVDWRTPAICPVFCDYYN
Download sequence
Identical sequences A0A093CA24

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]