SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093DQR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093DQR7
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily SNARE-like 2.84e-36
Family Clathrin coat assembly domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093DQR7
Sequence length 140
Comment (tr|A0A093DQR7|A0A093DQR7_TAUER) AP complex subunit sigma {ECO:0000256|PIRNR:PIRNR015588} KW=Complete proteome; Reference proteome OX=121530 OS=Tauraco erythrolophus (Red-crested turaco). GN=N340_06592 OC=Tauraco.
Sequence
MIKFFLMVNKQGQTRLSRYYEHVEINKRTMLEAEVIKNCLSRSKDQCSFIEYKDFKLVYR
QYAALFVVVGINETENEMAVYELIHNFVEVLDKYFSRVIMFNLDRVHIILDEMVLNGCIV
ETNRTRILAPLFVLDKVAES
Download sequence
Identical sequences A0A093DQR7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]