SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093EJU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093EJU8
Domain Number 1 Region: 3-263
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.19e-78
Family Protein kinases, catalytic subunit 0.0000155
Further Details:      
 
Domain Number 2 Region: 273-350
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000412
Family Regulator of G-protein signaling, RGS 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093EJU8
Sequence length 967
Comment (tr|A0A093EJU8|A0A093EJU8_9AVES) Mitogen-activated protein kinase kinase kinase 9 {ECO:0000313|EMBL:KFV14836.1} KW=Complete proteome; Reference proteome OX=240206 OS=Pterocles gutturalis (yellow-throated sandgrouse). GN=N339_13019 OC=Pterocles.
Sequence
FSELVLEEIIGIGGFGKVYRAVWIGDEVAVKAARYDPDEDISQTIENVRQEAKLFAMLKH
PNIIALRGVCLKEPNLCLIMEFARGGSLNRVLSGKRIPPDVLVNWAVQIARGMNYLHEEA
IVPIIHRDLKSSNILILEKVENGDLSNKILKITDFGLAREWHRTTKMSAAGTYAWMAPEV
IRSSMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMNKLALPIPSTCPEPFAK
LMEDCWNPDPHSRPSFASILDHLTAIQESGFFEMPKDSFHSLQEDWKQEIQEMFDQLRAK
EKELRTWEEELTRAAVEQKNHEELLRRREQELAEREIDILERELNIIIHQLCQEKPRVKK
RMGKFKRSRLKLKDGNHISLPSDFQHKFTVQASPTMDKRKSLISSCSSPPASPTIIPRLR
AIQCKELNVVLNLGNVHKTWGRSSVLPKEEGEEEEKRGQKKKGRTWGPSSLCHKELGAGE
DGLVVSMVHFLPSFYYFSLKALVEGYKQWSSSAPNLGKIQRTAPAFPGFTSLAEMDDEDS
ECLNGEGKVHPSPGHNQSYLCIPFQKNEDWDGPSSDANEESTPVNSATSTPQLTPTNSLK
RSGSHHKRCEVALLGCGAVLAAAGLGFDLLEAGKCQLLIEEEPDAPKEEKKKRDSIFQRA
GRPRRSTSPPSRKIFKKEDPMLLLGEPSTSLTLLSLSSISECNSTRSLLRSDSDEIVVYE
MPVSPVTVKAPLPVITNPLVNVQIERFKQDPNQSLTPTHVTVSSHTQQSKHRRTPSDGAI
KGSGLVVNGCPTSGCPSSSCLTGALGAGVLKTPSPSRDPNEVPRLPDPNLVFPPTPRRWN
AQQDPTLERPKTLEFLPRPRPAASRQRLDPWWFVSPSNAKGESSANSSSTDTPSNLDSCF
ASSSSTVEERPGLPALLPFQVGLPVEERTLLDIDAEGQSQDSTIPLCRSELNTHKAAAYE
LKQEFWS
Download sequence
Identical sequences A0A093EJU8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]