SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093ENG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093ENG2
Domain Number 1 Region: 70-160
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 2.64e-28
Family Platelet-derived growth factor-like 0.0000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093ENG2
Sequence length 222
Comment (tr|A0A093ENG2|A0A093ENG2_GAVST) Platelet-derived growth factor subunit B {ECO:0000313|EMBL:KFV46852.1} KW=Complete proteome; Reference proteome OX=37040 OS=Gavia stellata (Red-throated diver) (Red-throated loon). GN=N328_04078 OC=Coelurosauria; Aves; Neognathae; Gaviiformes; Gaviidae; Gavia.
Sequence
QGDPIPEDIYEILGGSSVRSISDLQRALQIDSVEEDSLNLDLNATQTGQNPVALSRKRRS
LDALAAAEPAVLAECKTRAVVFEISRNMVDSTNANFVVWPPCVEVQRCSGCCNNRNVQCR
PMQIRVRHVQVNKIEFVQRKPKFKKVVVPLEDHVQCRCEAVSRQPPRNSRPGPREQRRLS
PSFTTAAVSQRQRVRRPPAQKRKHKKYKHVNDKKVLKEILIA
Download sequence
Identical sequences A0A093ENG2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]