SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093ER87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093ER87
Domain Number 1 Region: 40-191
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.71e-30
Family Calponin-homology domain, CH-domain 0.0026
Further Details:      
 
Domain Number 2 Region: 210-289
Classification Level Classification E-value
Superfamily GAS2 domain-like 2.62e-28
Family GAS2 domain 0.0000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093ER87
Sequence length 335
Comment (tr|A0A093ER87|A0A093ER87_GAVST) GAS2-like 3 {ECO:0000313|EMBL:KFV46685.1} KW=Complete proteome; Reference proteome OX=37040 OS=Gavia stellata (Red-throated diver) (Red-throated loon). GN=N328_00808 OC=Coelurosauria; Aves; Neognathae; Gaviiformes; Gaviidae; Gavia.
Sequence
NLLQVWFGDDLPLSPRSPLTARHGPGLADVCLYDQWISVRHEATLVPMQEDLSIWLSGLL
GIEVKAEQLLEELDNGVLLCRLVGVLQNTVKKCCSSNNLRNFPMRKVPCKKDAPSGSFFA
RDNTANFLNWCRAIGVDETYLFESEGLVLHKDPRQVYLCLLEIGRIVSRYGVEPPVLVKL
EKEIELEETLLMSSGPPPVSTAKPCCHHGELHEAVKHIAEDPPCSCSHRFSIEYLSEGRY
RLGDKILFIRMLHGKHVMVRVGGGWDTLQGFLLKYDPCRVLQFATLEQKILAFQKGVTSD
SVPNSSARIQEPPVMNPMSAVNMFQKHPSKSPTPV
Download sequence
Identical sequences A0A093ER87

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]