SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093EZR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093EZR5
Domain Number 1 Region: 110-249
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 7.85e-45
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.0000382
Further Details:      
 
Domain Number 2 Region: 306-410
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.57e-25
Family Ubiquitin-related 0.00091
Further Details:      
 
Domain Number 3 Region: 1-95
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.29e-20
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093EZR5
Sequence length 412
Comment (tr|A0A093EZR5|A0A093EZR5_TYTAL) 2'-5'-oligoadenylate synthase-like 2 {ECO:0000313|EMBL:KFV47506.1} KW=Complete proteome; Reference proteome OX=56313 OS=Tyto alba (Barn owl). GN=N341_06535 OC=Coelurosauria; Aves; Neognathae; Strigiformes; Tytonidae; Tyto.
Sequence
KGTALQNNSDADVVLFLSHFSSYEQQKQERKYILDLIKRRLHACRQSLTFTVTISEPQYK
GPGNTPRSVSLTLHSRTTLESIKVDVLPAYDALGKDRGLARRWAFVSRSPAKLKNLLRLV
KHWYKEMLKPQYLNADLPPKYALELLTIYAWEEGTGSSDSFNMAEGFRTVLQLLCRPQEI
CIYWEMYYSLQHTQIGAHVKNLMRSHCPIILDPADPTGILGKNTQWDLMAQKAAQDLSLL
PCINNTQPWDVQPARLVFLWGAPALSRTVSPHTTIQQLKKQIEKEWNIPWYKQRLRQQEL
GRNTPVLQDGETLATYGIFYNTTLVLLQTEPQTIEILVKNDKNQTTTYMVQLTDTVRQLK
EKIHSNKGPSADQQYLTYDSRTLEDQHMLAHYDIQPKSTIYMNLKLRGGAGP
Download sequence
Identical sequences A0A093EZR5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]