SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093F3W9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093F3W9
Domain Number 1 Region: 24-91
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000165
Family Snake venom toxins 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093F3W9
Sequence length 97
Comment (tr|A0A093F3W9|A0A093F3W9_GAVST) Ly6/PLAUR domain-containing protein 6 {ECO:0000313|EMBL:KFV48916.1} KW=Complete proteome; Reference proteome OX=37040 OS=Gavia stellata (Red-throated diver) (Red-throated loon). GN=N328_02303 OC=Coelurosauria; Aves; Neognathae; Gaviiformes; Gaviidae; Gavia.
Sequence
PAVQPRDFTVKDIVYLHPSTTPYPHGFKCFTCEKAADNYECNRWAPDVYCPRGTRYCFSQ
HMMKVTGESVSVTKRCVPLEDCLSTGCTYVKHEEYKV
Download sequence
Identical sequences A0A093F3W9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]