SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093F7Z8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093F7Z8
Domain Number 1 Region: 8-118
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 2.75e-43
Family FAD-dependent thiol oxidase 0.00000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093F7Z8
Sequence length 119
Comment (tr|A0A093F7Z8|A0A093F7Z8_GAVST) Sulfhydryl oxidase {ECO:0000256|RuleBase:RU371123} KW=Complete proteome; Reference proteome OX=37040 OS=Gavia stellata (Red-throated diver) (Red-throated loon). GN=N328_09462 OC=Coelurosauria; Aves; Neognathae; Gaviiformes; Gaviidae; Gavia.
Sequence
EEKEPPPDCPLDSEQLGRNTWAFLHTMAAYYPDHPTGAQQKEMREFINLFSKFYPCEHCA
EDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVDERWRDGWKDGSCD
Download sequence
Identical sequences A0A093F7Z8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]