SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093FCT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093FCT1
Domain Number 1 Region: 113-244
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.06e-46
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.000022
Further Details:      
 
Domain Number 2 Region: 1-110
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.14e-22
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.0021
Further Details:      
 
Domain Number 3 Region: 281-354
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000193
Family Ubiquitin-related 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093FCT1
Sequence length 355
Comment (tr|A0A093FCT1|A0A093FCT1_GAVST) 2'-5'-oligoadenylate synthase-like 1 {ECO:0000313|EMBL:KFV52056.1} KW=Complete proteome; Reference proteome OX=37040 OS=Gavia stellata (Red-throated diver) (Red-throated loon). GN=N328_08190 OC=Coelurosauria; Aves; Neognathae; Gaviiformes; Gaviidae; Gavia.
Sequence
QGGSAGKGTALRNNSDADVVLFLSCFTSYQEQKQQRKQILDLIERRGGSRHGARLGRQRW
DGSHPPSHPAGHVSWDAQPDAGVYVGLLNASSDPGEFSPCFTELQKKFVKRHPAKLKNLL
RLVKHWYKEYPFADLPPKYALELLTIYAWEEGTGSCESFVMAEGFRTVLELLRRHQEICI
YWEKYYSLQHSQIGAHVKRLLRSPRPVILDPADPTGILGQGKNWDLVAREAARHCSLPCV
NTAQPWGVQVRLPAPAGIVAPPLLPAFQRLAQQQPGRSTLILHNDETLATHGIFYSTTLM
LLQTEPQAMEIFVKDDKNRTTTYMVQPTNTVRQLKEQIHARQGPPADQQCLTYGS
Download sequence
Identical sequences A0A093FCT1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]