SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093FFL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093FFL6
Domain Number 1 Region: 27-67
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000377
Family Fibronectin type I module 0.081
Further Details:      
 
Domain Number 2 Region: 2-29
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000432
Family ATI-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093FFL6
Sequence length 337
Comment (tr|A0A093FFL6|A0A093FFL6_GAVST) Mucin-5B {ECO:0000313|EMBL:KFV53054.1} KW=Complete proteome; Reference proteome OX=37040 OS=Gavia stellata (Red-throated diver) (Red-throated loon). GN=N328_04800 OC=Coelurosauria; Aves; Neognathae; Gaviiformes; Gaviidae; Gavia.
Sequence
TECVSGCMCPDGLVLDGSGGCIHKDQCPCVHGGHFYKPGESIKVDCNTCTCNKRQWNCTD
NPCKGTCTVYGNGHYMSFDGEKFDFLGDCDYILAQDFCPNNMDAGTFRIVIQNNACGKSL
SICSLKITLIFEVCLELVITEELLLEGRIQEIATDPGAEKNYKVDLRGGYIVIETNQGMN
FMWDQKTTVVVHVAPSFQGKVCGLCGDFDGRSRNDFTTRGQSVEMSIQEFGNSWKITSTC
SNINMTDLCADQPFKSVLGQKHCSIIKSNIFEACHSKVNPIPYYESCISDFCGCDSVGDC
ECFCTSVAAYSRSCSRAGVCIDWRTPAICPVFCDYYN
Download sequence
Identical sequences A0A093FFL6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]