SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093FN21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093FN21
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 6.8e-33
Family Nicotinic receptor ligand binding domain-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093FN21
Sequence length 104
Comment (tr|A0A093FN21|A0A093FN21_GAVST) Gamma-aminobutyric acid receptor subunit alpha-2 {ECO:0000313|EMBL:KFV58065.1} KW=Complete proteome; Reference proteome OX=37040 OS=Gavia stellata (Red-throated diver) (Red-throated loon). GN=N328_04325 OC=Coelurosauria; Aves; Neognathae; Gaviiformes; Gaviidae; Gavia.
Sequence
EYTIDVFFRQRWKDERLKFKGPMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKL
LRIQDDGTLLYTMRLTVQAECPMHLEDFPMDAHSCPLKFGSCKY
Download sequence
Identical sequences A0A093FN21

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]