SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093FNN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093FNN6
Domain Number 1 Region: 1-53
Classification Level Classification E-value
Superfamily SNARE fusion complex 3.19e-17
Family SNARE fusion complex 0.0000691
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093FNN6
Sequence length 74
Comment (tr|A0A093FNN6|A0A093FNN6_GAVST) Vesicle-associated membrane protein 1 {ECO:0000313|EMBL:KFV55929.1} KW=Complete proteome; Reference proteome OX=37040 OS=Gavia stellata (Red-throated diver) (Red-throated loon). GN=N328_08661 OC=Coelurosauria; Aves; Neognathae; Gaviiformes; Gaviidae; Gavia.
Sequence
QVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMMG
VICAIVVVVIVSKY
Download sequence
Identical sequences A0A093CL42 A0A093FNN6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]