SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093FVE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093FVE3
Domain Number 1 Region: 255-379
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.4e-31
Family cAMP-binding domain 0.000000645
Further Details:      
 
Domain Number 2 Region: 118-239
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.09e-29
Family cAMP-binding domain 0.000000661
Further Details:      
 
Domain Number 3 Region: 12-60
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.44e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093FVE3
Sequence length 388
Comment (tr|A0A093FVE3|A0A093FVE3_GAVST) cAMP-dependent protein kinase type I-alpha regulatory subunit {ECO:0000313|EMBL:KFV58299.1} KW=Complete proteome; Reference proteome OX=37040 OS=Gavia stellata (Red-throated diver) (Red-throated loon). GN=N328_08941 OC=Coelurosauria; Aves; Neognathae; Gaviiformes; Gaviidae; Gavia.
Sequence
AASSSSSEEERSLRECELYVQKHNIQQLLKDCIVQLCTVRPERPMGFLREYFERLEKEET
KQLLNQQKSGSRSDSREDEISPPPPMNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKD
YKTMAALAKAIEKNVLFAHLDDNERSDIFDAMFPVTYIAGETVIQQGNCDEGDNFYVVDQ
GEMDVYVNSEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMASI
FLADVTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFF
IILEGTAAVLQRRSENEEFVEVGRLAPSDYFGEIALLMNRPRAATVVARGLLKCVKLDRP
RFERVLGPCSDILKRNIQQYNSFVSLSV
Download sequence
Identical sequences A0A093FVE3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]