SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093FXI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093FXI1
Domain Number 1 Region: 71-154
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 5.89e-26
Family Thyroglobulin type-1 domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093FXI1
Sequence length 158
Comment (tr|A0A093FXI1|A0A093FXI1_GAVST) Insulin-like growth factor-binding protein 3 {ECO:0000313|EMBL:KFV59096.1} KW=Complete proteome; Reference proteome OX=37040 OS=Gavia stellata (Red-throated diver) (Red-throated loon). GN=N328_07850 OC=Coelurosauria; Aves; Neognathae; Gaviiformes; Gaviidae; Gavia.
Sequence
GNSSDSEEDDRSTSSVENQAIPNSHRVPDSKSHPPHIKIDIIRKVQAKNTQRYKVEYDSQ
STDTLNFSSESKQETEYGPCRREMEDTLNHLKILNVLSPRGFHIPNCDKKGFYKKKQCRP
SKGRKRGYCWCVDKYGQPLPGYDGKGKGDVHCYNLESK
Download sequence
Identical sequences A0A093FXI1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]