SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093FYJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093FYJ2
Domain Number 1 Region: 47-89
Classification Level Classification E-value
Superfamily WW domain 0.00000000000846
Family WW domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093FYJ2
Sequence length 124
Comment (tr|A0A093FYJ2|A0A093FYJ2_GAVST) Centrosomal protein of 164 kDa {ECO:0000313|EMBL:KFV59471.1} KW=Complete proteome; Reference proteome OX=37040 OS=Gavia stellata (Red-throated diver) (Red-throated loon). GN=N328_00835 OC=Coelurosauria; Aves; Neognathae; Gaviiformes; Gaviidae; Gavia.
Sequence
MAGAMVRIGDQLILEEDYDETYIPSEQEIQDFAREIGIDPEKEPELIWLAREGIVAPLPP
EWKPCQDITGDIYYFNFANGQSTWDHPCDDRYRELVIQEREKLLARGSLKKKEKKKKKEK
KEKK
Download sequence
Identical sequences A0A093FYJ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]