SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093FZS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093FZS0
Domain Number 1 Region: 65-125
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0000000000000275
Family AN1-like Zinc finger 0.0012
Further Details:      
 
Domain Number 2 Region: 2-39
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0000000124
Family AN1-like Zinc finger 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093FZS0
Sequence length 127
Comment (tr|A0A093FZS0|A0A093FZS0_DRYPU) AN1-type zinc finger protein 2B {ECO:0000313|EMBL:KFV63395.1} KW=Complete proteome; Reference proteome OX=118200 OS=Dryobates pubescens (Downy woodpecker) (Picoides pubescens). GN=N307_04366 OC=Coelurosauria; Aves; Neognathae; Piciformes; Picidae; Picoides.
Sequence
DFLPLKCDACEQIFCTDHIAYAQHDCTSAYKKDVQVPVCPLCNTPVPVRRGEMPDVVVGE
HIDRDCKSDPAQRKRKIFTNKCMKPGCRQKEMMKVICDQCHKNYCLKHRHPLDHDCSGAG
HPLSRAG
Download sequence
Identical sequences A0A093FZS0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]