SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093G2L1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093G2L1
Domain Number 1 Region: 50-166
Classification Level Classification E-value
Superfamily PX domain 2.35e-25
Family PX domain 0.0016
Further Details:      
 
Domain Number 2 Region: 170-237
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000241
Family First domain of FERM 0.094
Further Details:      
 
Domain Number 3 Region: 1-33
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000761
Family PDZ domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093G2L1
Sequence length 406
Comment (tr|A0A093G2L1|A0A093G2L1_DRYPU) Sorting nexin-27 {ECO:0000313|EMBL:KFV64405.1} KW=Complete proteome; Reference proteome OX=118200 OS=Dryobates pubescens (Downy woodpecker) (Picoides pubescens). GN=N307_14967 OC=Coelurosauria; Aves; Neognathae; Piciformes; Picidae; Picoides.
Sequence
NGVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFYDYTEKQAVP
ISIPTYKHVEQNGEKFVVYNVYMAGRQLCAKRYREFSILHQNLKREFSNFTFPRLPGKWP
FSLSEQQLDSRRRGLEEYLEKVCSIRVIGESDIMQEFLSESDENYNGVSDVELRVALPDI
STVTVRVKKNSTTDQVYQAVAAKVGMDSITANYFALFEVINHSFVRKLAPNEFPHKLYVQ
NYTSAVPGTCLTLRKWLFTTEEEVLLNDNDLAASYFFHQAVDDVKKGYIKAEEKSYQLQK
LCEQRKMVMYLNMLRTCEGYNEIIFPHCSCDSRRKGHVITAISIKHFKLHACTEEGQLEN
QVIAFEWEEMQRWDTDEEGMAFCFEYTRGEKKPRWVKIFTPYVSVP
Download sequence
Identical sequences A0A093G2L1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]