SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093GET6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093GET6
Domain Number 1 Region: 163-486
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.12e-75
Family Protein kinases, catalytic subunit 0.0000015
Further Details:      
 
Domain Number 2 Region: 34-183
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.28e-33
Family Regulator of G-protein signaling, RGS 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093GET6
Sequence length 550
Comment (tr|A0A093GET6|A0A093GET6_DRYPU) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=118200 OS=Dryobates pubescens (Downy woodpecker) (Picoides pubescens). GN=N307_08148 OC=Coelurosauria; Aves; Neognathae; Piciformes; Picidae; Picoides.
Sequence
MCDMGGLDNLIANTAYLQARKSGEGDTKEMQKRRKSLSLPKIEQCGEVRQSMVADYDNIC
EQQPIGKKFFRDFLETVPEYMVARDFLDEVSNWELAEDNVKSSTMENMITNFLKTGSKNS
LAFLSSDLSSKCQAATAKDYENVIQLAKEETKLFLKDKPFQDFQTSPFFDKFIQWKVFEK
QPVTEKYFYEFRVLGKGGFGEVCAIQVKNTGKMYACKKLDKKRLKKKGGEKMALLEKEIL
EKVNSPFIVTLAYAYESKSHLCLVMSLMNGGDLKYHIYNVGERGLEMKRVIFYSAQITCG
ILHLHSIKIVYRDMKPENVLLDDNGNCRLSDLGLAVQVKEGKSITQRAGTNGYMAPEILK
EEDYCYPVDWFAMGCSIYEMVAGRTPFKDYKEKVNKDEVKRRTLEDEVKFEHANFTEEAK
DICRLFLAKKKENRLGSRNEDDDPRKHSFFKTINFHRLEANLIDPPFVPDPSVVYAKDVA
DIADFSEVRGIEFDDKDKKFFKKFATGAVPIPWQEEIIETGLFEELNDPNRVEGGYANGG
EAKSGVCLLL
Download sequence
Identical sequences A0A093GET6
XP_009899248.1.92783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]