SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093GI93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093GI93
Domain Number 1 Region: 26-160
Classification Level Classification E-value
Superfamily BAG domain 1.83e-49
Family BAG domain 0.00000398
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093GI93
Sequence length 160
Comment (tr|A0A093GI93|A0A093GI93_DRYPU) BAG family molecular chaperone regulator 1 {ECO:0000313|EMBL:KFV66687.1} KW=Complete proteome; Reference proteome OX=118200 OS=Dryobates pubescens (Downy woodpecker) (Picoides pubescens). GN=N307_11322 OC=Coelurosauria; Aves; Neognathae; Piciformes; Picidae; Picoides.
Sequence
FSSLIFHVGKSLKELEQPLSALGVKNGCKVMLIGKRNSPEEEAELKKLKDLENSVEQIAN
KLEEVNKEFTSIQKGFLAKDLQAEALKQLDKRIKGTAEQFMKTLEQIDAITLPENFSDCK
LKKKALVKKVQVFLAQCDTIEGSIGQEIDKLQSKNLALAE
Download sequence
Identical sequences A0A093GI93

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]