SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093GM02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093GM02
Domain Number 1 Region: 353-541
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.55e-67
Family Regulator of G-protein signaling, RGS 0.0000066
Further Details:      
 
Domain Number 2 Region: 749-977
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-63
Family DBL homology domain (DH-domain) 0.00000000258
Further Details:      
 
Domain Number 3 Region: 978-1112
Classification Level Classification E-value
Superfamily PH domain-like 1.69e-42
Family Pleckstrin-homology domain (PH domain) 0.0000022
Further Details:      
 
Domain Number 4 Region: 70-150
Classification Level Classification E-value
Superfamily PDZ domain-like 6.44e-22
Family PDZ domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093GM02
Sequence length 1276
Comment (tr|A0A093GM02|A0A093GM02_DRYPU) Rho guanine nucleotide exchange factor 12 {ECO:0000313|EMBL:KFV68057.1} KW=Complete proteome; Reference proteome OX=118200 OS=Dryobates pubescens (Downy woodpecker) (Picoides pubescens). GN=N307_14381 OC=Coelurosauria; Aves; Neognathae; Piciformes; Picidae; Picoides.
Sequence
MSGTQSTITDRFPLKKPTRHGSILSRESPADKKQKVERCSSTHDFDPTDSSSKKTKSSSE
ESRSETYGLVQRCVVIQRDENGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNG
TLVTHSNHLEVVKLIKSGSYVALTVQGRPPGSPQIPLVDSEVDLAAFGHMSPIMSSPHSP
GTAVNAERITSPVLVGEENNIVHNQKVEILRKMLQKEQERLQSLQEEYSRSHTTRLLKEI
QETKKHIPQLQEQLSKATGSAQVTECVRLLCAESSRWASCHPCNISNLVYCAKRITALCI
SSLPCSFSSLTSNSPQDCQSGVGSPLSRVGPQIIGAEDDDFDTEQEQINGQCSCFQNIEL
LKSRPAHLAVLLHHVVSQFDPAALLCYLYTDLYKQTNSKETRRVFLEFYQFFLDRAANLK
VPVPEEISLELDRRRPELLPEELHRQFIQTMQDKVCPEVQRNLEDFRQKRSMGLTLAEGE
LSRLDAERVRDRNSVEKERACAEQIIAKIEEVLMTSQPLEEDRSSTMQYVILTYMKHLGV
KVKEPRNLEQKRGRIGFLPKIKQSIKKEKEGEEKGKRRGFPNILGPPRRPSRHDSSAIGR
AMEMQKPRHPKHLTTAASVSPEPPDPGKMRQSGSSSDGAEAPYQPANPMSPLAVGPFSSP
EGSKDSEAGLKQTGEAPPANDSMDGTPRTPNNTFEFPSPLENLQEEEGESERVVDMGTPK
PFRKTDSVGFADVQSEDELCDFDMDMDPPNWQQLVSREVLMGLKPYEIKRQEVINELFYT
ERAHVRTLKVLHNVFYQRVTREGILNSSDKRKIFSNLEDILGLHVALNDQMKAVRKRNET
SVIDEIGEDLLSWFSGPAEEKLKHATATFCSNQPFALEVIKSRQKKDSRFQTFVQDAESN
PLCRRLQLKDIIPKEMQRLTKYPLLLDNIAKYTELPEEKEKVKKAADHCRQILNHVNQAV
KESENKQHLEDYQRRLDLSYLKQSEDPMMDEFRNLDLTKRKMLHEGPLTWKVNRDKTIDL
YTLLLEDILVLLQKQDDKLVLKCHSKILASTADSKHTFSPIIKLNTVLVRQVATDNKAFF
VISMSENGAHIYELVAQTVSEKNVWQDLIAQMAGTVKMGSSRRVIPLPQSGPGEEEREEE
EQQKLKEQHDIPASSLRSPDKDLGLEAPLILNAQSSSPIMSEKSKVESLLVSERQFDKVQ
QADLTLKDPSACFEHTASSLPSVAEGQWALDALRNLGLLKQLLVQQFGFAEKGTHEDWQR
FPRFRTVSQEAQTESG
Download sequence
Identical sequences A0A093GM02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]