SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093GNS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093GNS9
Domain Number 1 Region: 52-182
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.46e-45
Family Regulator of G-protein signaling, RGS 0.00000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093GNS9
Sequence length 184
Comment (tr|A0A093GNS9|A0A093GNS9_DRYPU) Regulator of G-protein signaling 16 {ECO:0000313|EMBL:KFV68454.1} KW=Complete proteome; Reference proteome OX=118200 OS=Dryobates pubescens (Downy woodpecker) (Picoides pubescens). GN=N307_04699 OC=Coelurosauria; Aves; Neognathae; Piciformes; Picidae; Picoides.
Sequence
MCQGLAALPITCLERAKDLKSRLGILLHKPELGHRIRTSSKLQLGSRWSHQGRDSSQEAL
EWRESFDQLLKSKSGVTAFHTFLKTEFSEENLDFWLACEDFKKTRSKTKLASKANRIFEE
FVQNEAPREVNIDHETREITRKNLSGATSTCFNEAQAKTRTLMEKDSYPRFLKSASYQDM
TKQA
Download sequence
Identical sequences A0A093GNS9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]