SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093GVJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093GVJ8
Domain Number 1 Region: 270-401
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.68e-44
Family Regulator of G-protein signaling, RGS 0.00000208
Further Details:      
 
Domain Number 2 Region: 2-96
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.12e-26
Family DEP domain 0.0052
Further Details:      
 
Domain Number 3 Region: 198-259
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 1.96e-17
Family Transducin (heterotrimeric G protein), gamma chain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093GVJ8
Sequence length 430
Comment (tr|A0A093GVJ8|A0A093GVJ8_DRYPU) Regulator of G-protein signaling 11 {ECO:0000313|EMBL:KFV74318.1} KW=Complete proteome; Reference proteome OX=118200 OS=Dryobates pubescens (Downy woodpecker) (Picoides pubescens). GN=N307_01587 OC=Coelurosauria; Aves; Neognathae; Piciformes; Picidae; Picoides.
Sequence
RQMEKMIVSMQDPDMGIKMRNQRLLITVIPHAMTGNDIVEWLIQKYGISEEESLHLGNLI
VKHGYIYPLRDPRNLVLRADESPYRFQTPYFWTSTKWPATELDYAIYLAKKNIRKQGDLI
EHEKDNYNLLHKRINHTWDFVVMQAREQLRAAKQRRKGDRIVIDCQEQAYWLVNRPPPGA
PSVLEQGPERRNSHTTRVQLTKNMDYYKREIEYCRKAMARTRVKSSICLEGYIKFNEQYV
PHDPIMSGCLPSNPWITDDTTYWAMNAPTVPTPTKLRVERWGFNFSELLMDPLGRAQLLE
FLKKEFSAENLSFWEACEELRYGEQSRIDEIVDSIYQQFLAPGATRWVNIDSKTMERTLE
GIKTPHRYVMDDAQMHIYMLMKKDSYPRFLKSDLYKNLLAEAIIPPETKKQRVFPFMRKQ
RHSSPSPALL
Download sequence
Identical sequences A0A093GVJ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]