SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093GZI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093GZI4
Domain Number 1 Region: 1-39
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000158
Family Chromo domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093GZI4
Sequence length 221
Comment (tr|A0A093GZI4|A0A093GZI4_STRCA) Chromobox protein 7 {ECO:0000313|EMBL:KFV75718.1} KW=Complete proteome; Reference proteome OX=441894 OS=Struthio camelus australis. GN=N308_03289 OC=Struthio.
Sequence
GKVEYLVKWKGWPPKYSTWEPEDHILDPRLVVAYEEKEERDRASGYRKRGPKPKRLLLQR
LYGMDLRSAHKGKEKLCFSLARRFGGGDSSVPGAKPGQAEFSEKTGGAVLPFSLRKQRKN
QKYLRLSRKKFPRMTSLESRNCRHEFFLNDAVGLEARQGPEDWEAMQHTSKEADVDGSLP
WIPTVPPSEVTVTDITANSITVTFREAQVAEGFFRDRSAQF
Download sequence
Identical sequences A0A093GZI4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]