SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093H8R9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093H8R9
Domain Number 1 Region: 1-34
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000732
Family HIT zinc finger 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093H8R9
Sequence length 148
Comment (tr|A0A093H8R9|A0A093H8R9_DRYPU) Zinc finger HIT domain-containing protein 3 {ECO:0000313|EMBL:KFV75800.1} KW=Complete proteome; Reference proteome OX=118200 OS=Dryobates pubescens (Downy woodpecker) (Picoides pubescens). GN=N307_12407 OC=Coelurosauria; Aves; Neognathae; Piciformes; Picidae; Picoides.
Sequence
CGVCRAAGAKYRCPRCAAAYCSVPCCRTHKERCTPEPKREQERAAAGQGEPNRAGHLAGS
PWSVEDILTEDDEQDRVPQQKLKLLGESEELQGLLLNPHLRQLLLTLDQAEDKSSLMKKH
MQEPLFVEFADCCLRIVEPLEKENILPE
Download sequence
Identical sequences A0A093H8R9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]