SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093HBV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093HBV2
Domain Number 1 Region: 3-130
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.36e-45
Family Regulator of G-protein signaling, RGS 0.00000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093HBV2
Sequence length 132
Comment (tr|A0A093HBV2|A0A093HBV2_STRCA) Regulator of G-protein signaling 16 {ECO:0000313|EMBL:KFV80103.1} KW=Complete proteome; Reference proteome OX=441894 OS=Struthio camelus australis. GN=N308_02212 OC=Struthio.
Sequence
RDSSKEVLEWRESFDQLLKSKNGVTAFHTFLKTEFSEENLDFWLACEDFKKTRSKTKLAS
KANRIFEEFVQTEAPREVNIDHETREITRKNLSGATSACFNEAQAKTRTLMEKDSYPRFL
KSASYQDMTKQA
Download sequence
Identical sequences A0A093HBV2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]