SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093HC38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093HC38
Domain Number 1 Region: 18-151
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.33e-37
Family Regulator of G-protein signaling, RGS 0.00012
Further Details:      
 
Domain Number 2 Region: 327-416
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-26
Family Ras-binding domain, RBD 0.00022
Further Details:      
 
Domain Number 3 Region: 271-340
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.82e-19
Family Ras-binding domain, RBD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093HC38
Sequence length 471
Comment (tr|A0A093HC38|A0A093HC38_STRCA) Regulator of G-protein signaling 14 {ECO:0000313|EMBL:KFV76980.1} KW=Complete proteome; Reference proteome OX=441894 OS=Struthio camelus australis. GN=N308_15027 OC=Struthio.
Sequence
RGSNHSVNSLPGPQTTCSSTQKSVVSWAESFETLLQDRVAVTYFTEFLKKEFSAENVYFW
QACERFQQIPASDTQQLAQEARRIYDEFLSSHSVSPVNIDKQAWIGEDVLATPSPDMFRI
QQLQIFNLMKFDSYTRFVKSPLYQACLRAESQGQPLPDLRPHSRSSSPPPDLSKKSKLKL
GKSLPLGVEAAGSNTKSSPRRSFRKGERREPSWAGSGSAMLWRESQGSLNSSASLDLGFL
SSTSTTTSPWTESHRKSLGGTEAEPQAKPMKYCCVYLPDGTASLASVRPGQSIRDMLAGI
CEKRGFSLPDIKVYLVGNEQKALVLDQECSVLADQEVKLENRISFELVISSLNKTIRITA
KSTKRIREALQPVLGKYGVNVELVLLRRQGEPGALDLEKLVSTVAAQKLILETPAGNIWG
DTGASLMRCSSQEGSPTATEANTLWEMPSSFSRPRSSAATNLNRRTYDLEG
Download sequence
Identical sequences A0A093HC38

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]