SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093HDX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093HDX4
Domain Number 1 Region: 409-514
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000707
Family Regulator of G-protein signaling, RGS 0.0093
Further Details:      
 
Domain Number 2 Region: 105-218
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000124
Family Regulator of G-protein signaling, RGS 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093HDX4
Sequence length 527
Comment (tr|A0A093HDX4|A0A093HDX4_TYTAL) Regulator of G-protein signaling protein-like {ECO:0000313|EMBL:KFV52863.1} KW=Complete proteome; Reference proteome OX=56313 OS=Tyto alba (Barn owl). GN=N341_08053 OC=Coelurosauria; Aves; Neognathae; Strigiformes; Tytonidae; Tyto.
Sequence
PLVATIAATDMGLLLRDEVFVDFFNTFLNLPVFGQTPIYISSTGRWDLWPELPSHLPPRF
PPSHRTICKSSLCLHLVLCQKLLGFIRSGEAAKRLNWQSADRWLLEKCISGSQGMWHFRA
FVQGKAGEELTDFWLTTERLLGLDESDARQRDLYLSLLHRLKATHLREGSSIVTFCRTII
GSLLKARHLQPIITRREILSKMQEQALFIIQSYWLPKFFIHCKMAMQEEKLCQPLLQEYQ
ERSLQASPQEPSGFSENLFTMHIKRSQGLSGPYCSKKAKADIWTLVKEGRNTQEIKMPRF
QVQPKGQLGPVGSTKESHLDKDALGSIPQQSEHPANTAAFGDKGEATYPKRPRPSAEQVL
HLEYLCEEKVPSNLHASAPIVQLPSLKKLVKTLSFLPWALSAETCAGRPFRDFLKLQDRS
METHLLDLWHDLEEFLPVVLDTSRENSFFLRHLIGEKICRTYLEEGTIQKLPLETRTLRS
LRNHLMSGEFSPWIFRAQKEICKVLCCLYEEFLAEDDRTFLQFMVKG
Download sequence
Identical sequences A0A093HDX4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]