SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093HDX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093HDX9
Domain Number 1 Region: 119-240
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.23e-34
Family cAMP-binding domain 0.000000903
Further Details:      
 
Domain Number 2 Region: 248-372
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.5e-32
Family cAMP-binding domain 0.000000777
Further Details:      
 
Domain Number 3 Region: 15-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 2.62e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093HDX9
Sequence length 381
Comment (tr|A0A093HDX9|A0A093HDX9_TYTAL) cAMP-dependent protein kinase type I-beta regulatory subunit {ECO:0000313|EMBL:KFV52868.1} KW=Complete proteome; Reference proteome OX=56313 OS=Tyto alba (Barn owl). GN=N341_07709 OC=Coelurosauria; Aves; Neognathae; Strigiformes; Tytonidae; Tyto.
Sequence
MAAASSCSVEEDESLKGCELYVQKHNIQQILKECIVNLCIAKPDRPMKFLREHFEKLEKE
ECKQILARQKSSSQSDSHDDEISPPPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPK
DYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGDEGDNFYVIDQG
EVDVYVNGEWVTSIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGEKIVVQGEPGDDFFIITEGTA
SVLQRRSDNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLG
PCSEILKRNIQRYNSFISLTV
Download sequence
Identical sequences A0A091HIJ4 A0A093C7G8 A0A093HDX9 A0A2I0M0R3 E1C2U6
XP_005145336.1.78019 XP_005229019.1.75256 XP_005504591.1.63277 XP_009966583.1.75343 XP_010077686.1.40768 XP_010142045.1.100080 XP_021267617.1.32913 XP_414754.1.86415 ENSGALP00000005814 9031.ENSGALP00000005814 ENSGALP00000005814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]