SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093HG54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093HG54
Domain Number 1 Region: 1-168
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.86e-62
Family T-box 0.00000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093HG54
Sequence length 171
Comment (tr|A0A093HG54|A0A093HG54_STRCA) T-box transcription factor TBX18 {ECO:0000313|EMBL:KFV77962.1} KW=Complete proteome; Reference proteome OX=441894 OS=Struthio camelus australis. GN=N308_11576 OC=Struthio.
Sequence
RRMFPAMRVKISGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIH
PDSPASGETWMRQVISFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDCGDDLSPVK
PIPSGEGVKAFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGRNRW
Download sequence
Identical sequences A0A093HG54 A0A094KL80

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]