SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093HX53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093HX53
Domain Number 1 Region: 2-163
Classification Level Classification E-value
Superfamily I/LWEQ domain 4.58e-57
Family I/LWEQ domain 0.000000971
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093HX53
Sequence length 225
Comment (tr|A0A093HX53|A0A093HX53_TYTAL) Huntingtin-interacting protein 1 {ECO:0000313|EMBL:KFV59068.1} KW=Complete proteome; Reference proteome OX=56313 OS=Tyto alba (Barn owl). GN=N341_07756 OC=Coelurosauria; Aves; Neognathae; Strigiformes; Tytonidae; Tyto.
Sequence
QEMLSKARAGDTGVKLEVNERILGSCTGLMQAIHILVLASKDLQREIVESGRGAASPKEF
YAKNSRWTEGLISAAKAVGWGATVMVDAADLVVQGKGTFEELMVCSREIAASTAQLVAAS
KVKADKDSANLCKLQQASRGVNQATARVVASTKAGKSQVEEKESMDFSSMTLTQIKRQEM
DSQVRVLELENQLQKERQKLGELRKKHYELAGVAEGWEEDGEWIP
Download sequence
Identical sequences A0A093HX53

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]