SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093HXZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093HXZ9
Domain Number 1 Region: 2-72
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000537
Family Txnl5-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093HXZ9
Sequence length 75
Comment (tr|A0A093HXZ9|A0A093HXZ9_STRCA) Thioredoxin domain-containing protein 17 {ECO:0000313|EMBL:KFV84400.1} KW=Complete proteome; Reference proteome OX=441894 OS=Struthio camelus australis. GN=N308_15319 OC=Struthio.
Sequence
AEPIVRKELHNMPDGSVFIYCLVGDRAYWKDPNNEFRKNLKLTGVPTLLKYGTPQKLVEE
ECFKAELVRMLFTED
Download sequence
Identical sequences A0A093HXZ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]