SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093I3D1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093I3D1
Domain Number 1 Region: 161-300
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.69e-45
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.0000281
Further Details:      
 
Domain Number 2 Region: 1-159
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 8.99e-38
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.000069
Further Details:      
 
Domain Number 3 Region: 290-381
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000825
Family Ubiquitin-related 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093I3D1
Sequence length 415
Comment (tr|A0A093I3D1|A0A093I3D1_EURHL) 2'-5'-oligoadenylate synthase-like 2 {ECO:0000313|EMBL:KFV97209.1} KW=Complete proteome; Reference proteome OX=54383 OS=Eurypyga helias (Sunbittern). GN=N326_09307 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Eurypygidae; Eurypyga.
Sequence
CDFLKEDCFDTNIHVHKTVKGGSAGKGTALRNNSDADVVLFLSCFSSYEEQKQQRKHILD
LIERRAGAPPDGQPLTAXXXXXRYKGPGNTPRSLSLTLCSKETPESIEVDILPAYDALGQ
VSGDAPPDVEVYVGVLNASSDPGEFSPCFTELQKKFVKRYPPKLKNLLRLVKHWYKELLK
PEYPTANLPPKYALELLTIYAWEEGTGSSNSFVMAEGFRTVLELLRRHREICIYWETYYS
LQHCQVGAHVKKLLCSPRPVILDPADPTGILGQCKNWDLVAQAAAHHRCLPCVSTAKPWV
VQPTRHVTIAVKQLVGTSLSRTISPDTTVWQLKEDIEQAWGISRYRQRLVQQEPGTNAVI
LQDGETLASHGIFYDTTLMLLQTEPQEMEVFVKDDKNQTSTYTVQPTNTVQHLKE
Download sequence
Identical sequences A0A093I3D1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]