SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093I781 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093I781
Domain Number 1 Region: 164-506
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.77e-80
Family Protein kinases, catalytic subunit 0.000000547
Further Details:      
 
Domain Number 2 Region: 11-160
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.5e-44
Family Regulator of G-protein signaling, RGS 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093I781
Sequence length 531
Comment (tr|A0A093I781|A0A093I781_STRCA) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=441894 OS=Struthio camelus australis. GN=N308_14028 OC=Struthio.
Sequence
KRSGRSKKWKEMLKLPPVSYCEGIRHSIGKDYNQLCDKQPIGRLLFRQFCDSRPELKRCI
EFLDAVAEYEVSSDEKRIDCGLKVLETYFTNGSAAHLPEIPQETVNECKARLEKNPSKDL
FMDCTRVVHEYLSRGPFEAYQDSVYFSRFLQWKWLEKQPVTKHTFRHYRVLGKGGFGEVC
ACQVRATGKMYACKKLEKKRIKKRKGESMALNEKRILEKVNSRFVVSLSYTYETKDALCL
VLTIMNGGDLKFHIYNMGNPGFDEERAIFYAAELCCGLEDLQRERIVYRDLKPENILLDD
CGHIRISDLGLAVQIPEGETVRGRVGTVGYMAPEVLKNEKYTFSPDWWGLGCLIYEMIEG
QSPFRKHKERVKRDEIDRRVKEDQETYSDKFSEEAKSICRMLLAKNPVDRLGCTEDGAAI
VKQHPIFKNINFKRLEANMLEPPFLPDPRAVYCKDVLDIEQFSTVKGVNLDTTDDDFYSK
FVTGCVSIPWQNEMIETGCFEDINAYETDGTVSPDRERSPKPKRGFFHRLF
Download sequence
Identical sequences A0A093I781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]